Structure of PDB 1jk4 Chain A Binding Site BS01

Receptor Information
>1jk4 Chain A (length=79) Species: 9913 (Bos taurus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
LRQCLPCGPGGKGRCFGPSICCGDELGCFVGTAEALRCQEENYLPSPCQS
GQKPCGSGGRCAAAGICCNDESCVTEPEC
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1jk4 Structures of an Unliganded Neurophysin and its Vasopressin Complex: Implications for Binding and Allosteric Mechanisms
Resolution2.3 Å
Binding residue
(original residue number in PDB)		C10 G23 P24 C44 E47 N48 L50 P51 S52 P53 C54
Binding residue
(residue number reindexed from 1)		C4 G17 P18 C38 E41 N42 L44 P45 S46 P47 C48
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0005185 neurohypophyseal hormone activity
Cellular Component
GO:0005576 extracellular region

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:1jk4, PDBe:1jk4, PDBj:1jk4
PDBsum1jk4
PubMed11514677
UniProtP01180|NEU2_BOVIN Vasopressin-neurophysin 2-copeptin (Gene Name=AVP)

[Back to BioLiP]