Structure of PDB 1jk2 Chain A Binding Site BS01

Receptor Information
>1jk2 Chain A (length=85) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
RPYACPVESCDRRFSRSAELTRHIRIHTGQKPFQCRICMRNFSRSDHLTT
HIRTHTGEKPFACDICGRKFARSDERKRHTKIHLR
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1jk2 Rearrangement of side-chains in a Zif268 mutant highlights the complexities of zinc finger-DNA recognition.
Resolution1.65 Å
Binding residue
(original residue number in PDB)		R103 F116 R118 E121 R124 H125 I128 R142 S145 R146 H149 H153 T156 R170 R174 E177 R180
Binding residue
(residue number reindexed from 1)		R1 F14 R16 E19 R22 H23 I26 R40 S43 R44 H47 H51 T54 R68 R72 E75 R78
Binding affinityPDBbind-CN: Kd=43pM
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:1jk2, PDBe:1jk2, PDBj:1jk2
PDBsum1jk2
PubMed11800559
UniProtP08046|EGR1_MOUSE Early growth response protein 1 (Gene Name=Egr1)

[Back to BioLiP]