Structure of PDB 1jj4 Chain A Binding Site BS01

Receptor Information
>1jj4 Chain A (length=74) Species: 333761 (human papillomavirus 18) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MTPIIHLKGDRNSLKCLRYRLRKHSDHYRDISSTWHWTKTGILTVTYHSE
TQRTKFLNTVAIPDSVQILVGYMT
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1jj4 The structural basis of DNA target discrimination by papillomavirus E2 proteins.
Resolution2.4 Å
Binding residue
(original residue number in PDB)		R296 K300 R303 Y304 R307 S318 T319
Binding residue
(residue number reindexed from 1)		R11 K15 R18 Y19 R22 S33 T34
Binding affinityPDBbind-CN: Kd=1.6nM
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003700 DNA-binding transcription factor activity
Biological Process
GO:0006275 regulation of DNA replication
GO:0006355 regulation of DNA-templated transcription
Cellular Component
GO:0042025 host cell nucleus

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1jj4, PDBe:1jj4, PDBj:1jj4
PDBsum1jj4
PubMed10906136
UniProtP06790|VE2_HPV18 Regulatory protein E2 (Gene Name=E2)

[Back to BioLiP]