Structure of PDB 1jh9 Chain A Binding Site BS01

Receptor Information

>1jh9 Chain A (length=339) Species: 562 (Escherichia coli)

ATIKDVAKRANVSTTTVSHVINKTRFVAEETRNAVWAAIKELHYSPSAVA
RSLKVNHTKSIGLLATSSEAAYFAEIIEAVEKNCFQKGYTLILGNAWNNL
EKQRAYLSMMAQKRVDGLLVMCSEYPEPLLAMLEEYRHIPMVVMDRGEAK
ADFTDAVIDNAFEGGYMAGRYLIERGHREIGVIPGPLERNTGAGRLAGFM
KAMEEAMIKVPESWIVQGDFEPESGYRAMQQILSQPHRPTAVFCGGDIMA
MGALCAADEMGLRVPQDVSLIGYDNVRNARYFTPALTTIHQPKDSLGETA
FNMLLDRIVNKREEPQSIEVHPRLIERRSVADGPFRDYR

Ligand information

>1jh9 Chain B (length=17)

aacgaaaacgttttcgt

Receptor-Ligand Complex Structure

Structure summary

• PDB: 1jh9 Role of residue 147 in the gene regulatory function of the Escherichia coli purine repressor.
• Resolution: 2.55 Å
• Binding residue (original residue number in PDB): V13 S14 T16 T17 R26 A29 T32 L54 K55
• Binding residue (residue number reindexed from 1): V12 S13 T15 T16 R25 A28 T31 L53 K54
• Binding affinity: PDBbind-CN: Kd=2nM

Gene Ontology

Molecular Function

• GO:0000976 transcription cis-regulatory region binding
• GO:0001217 DNA-binding transcription repressor activity
• GO:0002057 guanine binding
• GO:0003677 DNA binding
• GO:0003700 DNA-binding transcription factor activity
• GO:0005515 protein binding
• GO:0042803 protein homodimerization activity

Biological Process

• GO:0006164 purine nucleotide biosynthetic process
• GO:0006355 regulation of DNA-templated transcription
• GO:0045892 negative regulation of DNA-templated transcription
• GO:1900372 negative regulation of purine nucleotide biosynthetic process

Cellular Component

• GO:0005829 cytosol

External links

• PDB: RCSB:1jh9, PDBe:1jh9, PDBj:1jh9
• PDBsum: 1jh9
• PubMed: 11781089
• UniProt: P0ACP7|PURR_ECOLI HTH-type transcriptional repressor PurR (Gene Name=purR)