Structure of PDB 1jh4 Chain A Binding Site BS01

Receptor Information
>1jh4 Chain A (length=98) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GPLGSPLTASMLASAPPQEQKQMLGERLFPLIQAMHPTLAGKITGMLLEI
DNSELLHMLESPESLRSKVDEAVAVLQAHQAKEAAQKAVNSATGVPTV
Ligand information
>1jh4 Chain B (length=22) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
VLMSKLSVNAPEFYPSGYSSSY
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1jh4 Structural basis of ligand recognition by PABC, a highly specific peptide-binding domain found in poly(A)-binding protein and a HECT ubiquitin ligase
ResolutionN/A
Binding residue
(original residue number in PDB)		Q18 Q20 K21 Q22 M23 G25 E26 G41 K42 T44 G45 M46 L47 L48 E49 N52 E71 A72 A74 V75 H79
Binding residue
(residue number reindexed from 1)		Q18 Q20 K21 Q22 M23 G25 E26 G41 K42 T44 G45 M46 L47 L48 E49 N52 E71 A72 A74 V75 H79
Enzymatic activity
Enzyme Commision number ?
Gene Ontology

View graph for
Molecular Function
External links
PDB RCSB:1jh4, PDBe:1jh4, PDBj:1jh4
PDBsum1jh4
PubMed14685257
UniProtP11940|PABP1_HUMAN Polyadenylate-binding protein 1 (Gene Name=PABPC1)

[Back to BioLiP]