Structure of PDB 1jgd Chain A Binding Site BS01

Receptor Information
>1jgd Chain A (length=276) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GSHSMRYFHTSVSRPGRGEPRFITVGYVDDTLFVRFDSDAASPREEPRAP
WIEQEGPEYWDRETQICKAKAQTDREDLRTLLRYYNQSEAGSHTLQNMYG
CDVGPDGRLLRGYHQHAYDGKDYIALNEDLSSWTAADTAAQITQRKWEAA
RVAEQLRAYLEGECVEWLRRYLENGKETLQRADPPKTHVTHHPISDHEAT
LRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDRTFQKWAAVVVP
SGEEQRYTCHVQHEGLPKPLTLRWEP
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1jgd Thermodynamic and structural analysis of peptide- and allele-dependent properties of two HLA-B27 subtypes exhibiting differential disease association
Resolution1.9 Å
Binding residue
(original residue number in PDB)
Y7 H9 T24 E45 R62 E63 I66 C67 T73 E76 D77 T80 Y84 Y99 H116 Y123 T143 K146 W147 V152 Q155 L156 Y159 E163 W167 Y171
Binding residue
(residue number reindexed from 1)
Y7 H9 T24 E45 R62 E63 I66 C67 T73 E76 D77 T80 Y84 Y99 H116 Y123 T143 K146 W147 V152 Q155 L156 Y159 E163 W167 Y171
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:1jgd, PDBe:1jgd, PDBj:1jgd
PDBsum1jgd
PubMed14555655
UniProtP01889|HLAB_HUMAN HLA class I histocompatibility antigen, B alpha chain (Gene Name=HLA-B)

[Back to BioLiP]