Structure of PDB 1jg3 Chain A Binding Site BS01

Receptor Information
>1jg3 Chain A (length=215) Species: 2261 (Pyrococcus furiosus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
EKELYEKWMRTVEMLKAEGIIRSKEVERAFLKYPRYLSVEDKYKKYAHID
EPLPIPAGQTVSAPHMVAIMLEIANLKPGMNILEVGTGSGWNAALISEIV
KTDVYTIERIPELVEFAKRNLERAGVKNVHVILGDGSKGFPPKAPYDVII
VTAGAPKIPEPLIEQLKIGGKLIIPVGSYHLWQELLEVRKTKDGIKIKNH
GGVAFVPLIGEYGWK
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1jg3 Crystal structure of a protein repair methyltransferase from Pyrococcus furiosus with its L-isoaspartyl peptide substrate.
Resolution2.1 Å
Binding residue
(original residue number in PDB)		P65 P67 T73 S75 A76 H78 M79 V216 A217 F218 V219
Binding residue
(residue number reindexed from 1)		P52 P54 T60 S62 A63 H65 M66 V203 A204 F205 V206
Enzymatic activity
Catalytic site (original residue number in PDB) S75
Catalytic site (residue number reindexed from 1) S62
Enzyme Commision number 2.1.1.77: protein-L-isoaspartate(D-aspartate) O-methyltransferase.
Gene Ontology
Molecular Function
GO:0004719 protein-L-isoaspartate (D-aspartate) O-methyltransferase activity
GO:0008168 methyltransferase activity
GO:0016740 transferase activity
Biological Process
GO:0030091 protein repair
GO:0032259 methylation
GO:0036211 protein modification process
Cellular Component
GO:0005737 cytoplasm

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1jg3, PDBe:1jg3, PDBj:1jg3
PDBsum1jg3
PubMed11700066
UniProtQ8TZR3|PIMT_PYRFU Protein-L-isoaspartate O-methyltransferase (Gene Name=pcm)

[Back to BioLiP]