Structure of PDB 1jd6 Chain A Binding Site BS01

Receptor Information
>1jd6 Chain A (length=102) Species: 7227 (Drosophila melanogaster) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
NYFPQYPEYAIETARLRTFEAWPRNLKQKPHQLAEAGFFYTGVGDRVRCF
SCGGGLMDWNDNDEPWEQHALWLSQCRFVKLMKGQLYIDTVAAKPVLAEE
KE
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1jd6 Structural analysis of a functional DIAP1 fragment bound to grim and hid peptides.
Resolution2.7 Å
Binding residue
(original residue number in PDB)		R260 V261 R262 G267 G268 G269 L270 M271 D277 Q282 W286 L287
Binding residue
(residue number reindexed from 1)		R46 V47 R48 G53 G54 G55 L56 M57 D63 Q68 W72 L73
Enzymatic activity
Enzyme Commision number 2.3.2.27: RING-type E3 ubiquitin transferase.
External links
PDB RCSB:1jd6, PDBe:1jd6, PDBj:1jd6
PDBsum1jd6
PubMed11511363
UniProtQ24306|DIAP1_DROME Death-associated inhibitor of apoptosis 1 (Gene Name=Diap1)

[Back to BioLiP]