Structure of PDB 1jbd Chain A Binding Site BS01

Receptor Information
>1jbd Chain A (length=74) Species: 8616 (Bungarus multicinctus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
IVCHTTATSPISAVTCPPGENLCYRKMWCDAFCSSRGKVVELGCAATCPS
KKPYEEVTCCSTDKCNPHPKQRPG
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1jbd NMR structure of alpha-bungarotoxin free and bound to a mimotope of the nicotinic acetylcholine receptor.
ResolutionN/A
Binding residue
(original residue number in PDB)		T6 A7 T8 S9 P10 C29 D30 C33 S34 R36 K38 V39 H68 P69 K70
Binding residue
(residue number reindexed from 1)		T6 A7 T8 S9 P10 C29 D30 C33 S34 R36 K38 V39 H68 P69 K70
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0005515 protein binding
GO:0030550 acetylcholine receptor inhibitor activity
GO:0090729 toxin activity
GO:0099106 ion channel regulator activity
Biological Process
GO:0035821 modulation of process of another organism
Cellular Component
GO:0005576 extracellular region

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1jbd, PDBe:1jbd, PDBj:1jbd
PDBsum1jbd
PubMed11814338
UniProtP60615|3L21A_BUNMU Alpha-bungarotoxin

[Back to BioLiP]