Structure of PDB 1j75 Chain A Binding Site BS01

Receptor Information
>1j75 Chain A (length=57) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
NLEQKILQVLSDDGGPVKIGQLVKKCQVPKKTLNQVLYRLKKEDRVSSPE
PATWSIG
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1j75 Structure of the DLM-1-Z-DNA complex reveals a conserved family of Z-DNA-binding proteins.
Resolution1.85 Å
Binding residue
(original residue number in PDB)		K143 N146 Q147 Y150 P163
Binding residue
(residue number reindexed from 1)		K31 N34 Q35 Y38 P51
Binding affinityPDBbind-CN: Kd=35nM
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003723 RNA binding
GO:0003726 double-stranded RNA adenosine deaminase activity
Biological Process
GO:0060340 positive regulation of type I interferon-mediated signaling pathway

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:1j75, PDBe:1j75, PDBj:1j75
PDBsum1j75
PubMed11524677
UniProtQ9QY24|ZBP1_MOUSE Z-DNA-binding protein 1 (Gene Name=Zbp1)

[Back to BioLiP]