Structure of PDB 1j4w Chain A Binding Site BS01

Receptor Information
>1j4w Chain A (length=145) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GSHMIDVPIPRFAVGIVIGRNGEMIKKIQNDAGVRIQFKPDDGTTPERIA
QITGPPDRAQHAAEIITDLLRSVQQEFNFIVPTGKTGLIIGKGGETIKSI
SQQSGARIELQRNPPPNADPNMKLFTIRGTPQQIDYARQLIEEKI
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1j4w Structure and dynamics of KH domains from FBP bound to single-stranded DNA.
ResolutionN/A
Binding residue
(original residue number in PDB)		R11 F12 I18 N21 Q37 G113 T115 G116 I119 K127 R136 E138 L139
Binding residue
(residue number reindexed from 1)		R11 F12 I18 N21 Q37 G84 T86 G87 I90 K98 R107 E109 L110
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding
GO:0003723 RNA binding

View graph for
Molecular Function
External links
PDB RCSB:1j4w, PDBe:1j4w, PDBj:1j4w
PDBsum1j4w
PubMed11875576
UniProtQ96AE4|FUBP1_HUMAN Far upstream element-binding protein 1 (Gene Name=FUBP1)

[Back to BioLiP]