Structure of PDB 1j47 Chain A Binding Site BS01

Receptor Information
>1j47 Chain A (length=85) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MQDRVKRPINAFIVWSRDQRRKMALENPRMRNSEISKQLGYQWKMLTEAE
KWPFFQEAQKLQAMHREKYPNYKYRPRRKAKMLPK
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1j47 Structural basis for SRY-dependent 46-X,Y sex reversal: modulation of DNA bending by a naturally occurring point mutation.
ResolutionN/A
Binding residue
(original residue number in PDB)		K6 R7 I13 R20 R31 N32 Y74 R77 K79
Binding residue
(residue number reindexed from 1)		K6 R7 I13 R20 R31 N32 Y74 R77 K79
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:1j47, PDBe:1j47, PDBj:1j47
PDBsum1j47
PubMed11563911
UniProtQ05066|SRY_HUMAN Sex-determining region Y protein (Gene Name=SRY)

[Back to BioLiP]