Structure of PDB 1j2x Chain A Binding Site BS01

Receptor Information
>1j2x Chain A (length=70) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GPLDVQVTEDAVRRYLTRKPMTTKDLLKKFQTKKTGLSSEQTVNVLAQIL
KRLNPERKMINDKMHFSLKE
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1j2x Molecular mechanism of recruitment of TFIIF- associating RNA polymerase C-terminal domain phosphatase (FCP1) by transcription factor IIF
Resolution2.0 Å
Binding residue
(original residue number in PDB)		T470 K471 L474 S486 E487 V490 N491 A494 K498
Binding residue
(residue number reindexed from 1)		T23 K24 L27 S39 E40 V43 N44 A47 K51
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0006367 transcription initiation at RNA polymerase II promoter
GO:0032968 positive regulation of transcription elongation by RNA polymerase II
Cellular Component
GO:0005634 nucleus

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1j2x, PDBe:1j2x, PDBj:1j2x
PDBsum1j2x
PubMed12591941
UniProtP35269|T2FA_HUMAN General transcription factor IIF subunit 1 (Gene Name=GTF2F1)

[Back to BioLiP]