Structure of PDB 1ize Chain A Binding Site BS01

Receptor Information

>1ize Chain A (length=323) Species: 5062 (Aspergillus oryzae) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

AATGSVTTNPTSNDEEYITQVTVGDDTLGLDFDTGSADLWVFSSQTPSSE
RSGHDYYTPGSSAQKIDGATWSISYGDGSSASGDVYKDKVTVGGVSYDSQ
AVESAEKVSSEFTQDTANDGLLGLAFSSINTVQPTPQKTFFDNVKSSLSE
PIFAVALKHNAPGVYDFGYTDSSKYTGSITYTDVDNSQGFWGFTADGYSI
GSDSSSDSITGIADTGTTLLLLDDSIVDAYYEQVNGASYDSSQGGYVFPS
SASLPDFSVTIGDYTATVPGEYISFADVGNGQTFGGIQSNSGIGFSIFGD
VFLKSQYVVFDASGPRLGFAAQA

Ligand information

>1ize Chain B (length=6) Species: 285516 (Streptomyces argenteolus subsp. toyonakensis) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

VVVLAL

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	1ize Crystal structures of Aspergillus oryzae aspartic proteinase and its complex with an inhibitor pepstatin at 1.9A resolution.
Resolution	1.9 Å
Binding residue (original residue number in PDB)	E15 D33 G35 S74 Y75 G76 D77 E111 F190 D214 G216 T217 T218
Binding residue (residue number reindexed from 1)	E15 D33 G35 S74 Y75 G76 D77 E111 F190 D214 G216 T217 T218

Enzymatic activity

Catalytic site (original residue number in PDB)	D33 S36 D38 W40 Y75 D214 T217
Catalytic site (residue number reindexed from 1)	D33 S36 D38 W40 Y75 D214 T217
Enzyme Commision number	3.4.23.18: aspergillopepsin I.

Gene Ontology

	Molecular Function
GO:0004190	aspartic-type endopeptidase activity

	Biological Process
GO:0006508	proteolysis

View graph for
Molecular Function

View graph for
Biological Process

External links

PDB	RCSB:1ize, PDBe:1ize, PDBj:1ize
PDBsum	1ize
PubMed	12595261
UniProt	P0CU33\|PEPA_ASPOZ Aspergillopepsin-1 (Gene Name=pepA)

[Back to BioLiP]