Structure of PDB 1iv6 Chain A Binding Site BS01

Receptor Information
>1iv6 Chain A (length=57) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
RKRQAWLWEEDKNLRSGVRKYGEGNWSKILLHYKFNNRTSVMLKDRWRTM
KKLKLIS
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1iv6 Solution structure of a telomeric DNA complex of human TRF1.
ResolutionN/A
Binding residue
(original residue number in PDB)
K379 R380 N402 W403 S404 S417 K421 R425
Binding residue
(residue number reindexed from 1)
K2 R3 N25 W26 S27 S40 K44 R48
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:1iv6, PDBe:1iv6, PDBj:1iv6
PDBsum1iv6
PubMed11738049
UniProtP54274|TERF1_HUMAN Telomeric repeat-binding factor 1 (Gene Name=TERF1)

[Back to BioLiP]