Structure of PDB 1iuz Chain A Binding Site BS01

Receptor Information

>1iuz Chain A (length=98) Species: 3120 (Ulva pertusa)

AQIVKLGGDDGSLAFVPSKISVAAGEAIEFVNNAGFPHNIVFDEDAVPAG
VDADAISYDDYLNSKGETVVRKLSTPGVYGVYCEPHAGAGMKMTITVQ

Ligand information

• Ligand ID: CU
• InChI: InChI=1S/Cu/q+2
• InChIKey: JPVYNHNXODAKFH-UHFFFAOYSA-N
• SMILES:
  ACDLabs 10.04
  OpenEye OEToolkits 1.5.0: [Cu+2]
  CACTVS 3.341: [Cu++]
• Formula: Cu
• Name: COPPER (II) ION
• DrugBank: DB14552
• PDB chain: 1iuz Chain A Residue 100

Receptor-Ligand Complex Structure

Structure summary

• PDB: 1iuz Novel insight into the copper-ligand geometry in the crystal structure of Ulva pertusa plastocyanin at 1.6-A resolution. Structural basis for regulation of the copper site by residue 88.
• Resolution: 1.6 Å
• Binding residue (original residue number in PDB): H37 C84 H87 M92
• Binding residue (residue number reindexed from 1): H38 C83 H86 M91
• Annotation score: 3

Enzymatic activity

• Catalytic site (original residue number in PDB): H37 C84 H87 M92
• Catalytic site (residue number reindexed from 1): H38 C83 H86 M91

Gene Ontology

Molecular Function

• GO:0005507 copper ion binding
• GO:0009055 electron transfer activity
• GO:0046028 electron transporter, transferring electrons from cytochrome b6/f complex of photosystem II activity
• GO:0046872 metal ion binding

Biological Process

• GO:0051607 defense response to virus

Cellular Component

• GO:0009507 chloroplast
• GO:0009535 chloroplast thylakoid membrane
• GO:0009543 chloroplast thylakoid lumen
• GO:0009579 thylakoid
• GO:0016020 membrane

External links

• PDB: RCSB:1iuz, PDBe:1iuz, PDBj:1iuz
• PDBsum: 1iuz
• PubMed: 9933621
• UniProt: P56274|PLAS_ULVPE Plastocyanin (Gene Name=PETE)