Structure of PDB 1isq Chain A Binding Site BS01

Receptor Information
>1isq Chain A (length=240) Species: 2261 (Pyrococcus furiosus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PFEIVFEGAKEFAQLIDTASKLIDEAAFKVTEDGISMRAMDPSRVVLIDL
NLPSSIFSKYEVVEPETIGVNLDHLKKILKRGKAKDTLILKKGEENFLEI
TIQGTATRTFRVPLIDVEPELPFTAKVVVLGEVLKDAVKDASLVSDSIKF
IARENEFIMKAEGETQEVEIKLTLEDEGLLDIEVQEETKSAYGVSYLSDM
VKGLGKADEVTIKFGNEMPMQMEYYIRDEGRLTFLLAPRV
Ligand information
>1isq Chain B (length=8) Species: 186497 (Pyrococcus furiosus DSM 3638) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
KQATLFDF
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1isq Physical interaction between proliferating cell nuclear antigen and replication factor C from Pyrococcus furiosus
Resolution2.3 Å
Binding residue
(original residue number in PDB)		R45 V46 V47 L48 M225 P226 A244 P245 R246 V247
Binding residue
(residue number reindexed from 1)		R44 V45 V46 L47 M218 P219 A237 P238 R239 V240
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0005515 protein binding
GO:0030337 DNA polymerase processivity factor activity
Biological Process
GO:0006260 DNA replication
GO:0006272 leading strand elongation
GO:0006275 regulation of DNA replication

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:1isq, PDBe:1isq, PDBj:1isq
PDBsum1isq
PubMed12296822
UniProtO73947|PCNA_PYRFU DNA polymerase sliding clamp (Gene Name=pcn)

[Back to BioLiP]