Structure of PDB 1irs Chain A Binding Site BS01

Receptor Information
>1irs Chain A (length=112) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MGPAFKEVWQVILKPKGLGQTKNLIGIYRLCLTSKTISFVKLNSEAAAVV
LQLMNIRRCGHSENFFFIEVGRSAVTGPGEFWMQVDDSVVAQNMHETILE
AMRAMSDEFRPR
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1irs Structural basis for IL-4 receptor phosphopeptide recognition by the IRS-1 PTB domain.
ResolutionN/A
Binding residue
(original residue number in PDB)		L208 M209 N210 I211 R212 R213 C214 G215 H216 S217 R227 M257 R258 M260 S261
Binding residue
(residue number reindexed from 1)		L53 M54 N55 I56 R57 R58 C59 G60 H61 S62 R72 M102 R103 M105 S106
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0005158 insulin receptor binding
Biological Process
GO:0008286 insulin receptor signaling pathway

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:1irs, PDBe:1irs, PDBj:1irs
PDBsum1irs
PubMed8599766
UniProtP35568|IRS1_HUMAN Insulin receptor substrate 1 (Gene Name=IRS1)

[Back to BioLiP]