Structure of PDB 1ipc Chain A Binding Site BS01

Receptor Information
>1ipc Chain A (length=186) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
EVANPEHYIKHPLQNRWALWFFKNDKSKTWQANLRLISKFDTVEDFWALY
NHIQLSSNLMPGCDYSLFKDGIEPMWEDEKNKRGGRWLITLNKQQRRSDL
DRFWLETLLCLIGESFDDYSDDVCGAVVNVRAKGDKIAIWTTECENREAV
THIGRVYKERLGLPPKIVIGYQSHADTATTKNRFVV
Ligand information
Ligand IDMGP
InChIInChI=1S/C11H18N5O14P3/c1-15-3-16(8-5(15)9(19)14-11(12)13-8)10-7(18)6(17)4(28-10)2-27-32(23,24)30-33(25,26)29-31(20,21)22/h3-4,6-7,10,17-18H,2H2,1H3,(H6-,12,13,14,19,20,21,22,23,24,25,26)/p+1/t4-,6-,7-,10-/m1/s1
InChIKeyDKVRNHPCAOHRSI-KQYNXXCUSA-O
SMILES
SoftwareSMILES
OpenEye OEToolkits 1.5.0C[n+]1cn(c2c1C(=O)NC(=N2)N)[C@H]3[C@@H]([C@@H]([C@H](O3)CO[P@@](=O)(O)O[P@@](=O)(O)OP(=O)(O)O)O)O
CACTVS 3.341C[n+]1cn([C@@H]2O[C@H](CO[P@](O)(=O)O[P@](O)(=O)O[P](O)(O)=O)[C@@H](O)[C@H]2O)c3N=C(N)NC(=O)c13
OpenEye OEToolkits 1.5.0C[n+]1cn(c2c1C(=O)NC(=N2)N)C3C(C(C(O3)COP(=O)(O)OP(=O)(O)OP(=O)(O)O)O)O
ACDLabs 10.04O=P(O)(O)OP(=O)(O)OP(=O)(O)OCC3OC(n2c[n+](c1c2N=C(N)NC1=O)C)C(O)C3O
CACTVS 3.341C[n+]1cn([CH]2O[CH](CO[P](O)(=O)O[P](O)(=O)O[P](O)(O)=O)[CH](O)[CH]2O)c3N=C(N)NC(=O)c13
FormulaC11 H19 N5 O14 P3
Name7-METHYL-GUANOSINE-5'-TRIPHOSPHATE
ChEMBLCHEMBL1234303
DrugBankDB02716
ZINCZINC000015601432
PDB chain1ipc Chain A Residue 1000 [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1ipc Crystal structures of 7-methylguanosine 5'-triphosphate (m(7)GTP)- and P(1)-7-methylguanosine-P(3)-adenosine-5',5'-triphosphate (m(7)GpppA)-bound human full-length eukaryotic initiation factor 4E: biological importance of the C-terminal flexible region
Resolution2.0 Å
Binding residue
(original residue number in PDB)
W56 M101 W102 E103 R157 K162
Binding residue
(residue number reindexed from 1)
W30 M75 W76 E77 R131 K136
Annotation score1
Binding affinityBindingDB: Ki=28nM
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0000339 RNA cap binding
GO:0000340 RNA 7-methylguanosine cap binding
GO:0003723 RNA binding
GO:0003743 translation initiation factor activity
GO:0005515 protein binding
GO:0019899 enzyme binding
GO:0031370 eukaryotic initiation factor 4G binding
GO:0098808 mRNA cap binding
GO:0140297 DNA-binding transcription factor binding
Biological Process
GO:0000082 G1/S transition of mitotic cell cycle
GO:0001662 behavioral fear response
GO:0006406 mRNA export from nucleus
GO:0006412 translation
GO:0006413 translational initiation
GO:0006417 regulation of translation
GO:0010507 negative regulation of autophagy
GO:0017148 negative regulation of translation
GO:0019827 stem cell population maintenance
GO:0030182 neuron differentiation
GO:0045665 negative regulation of neuron differentiation
GO:0045931 positive regulation of mitotic cell cycle
GO:0051028 mRNA transport
GO:0051168 nuclear export
GO:0071549 cellular response to dexamethasone stimulus
GO:0099578 regulation of translation at postsynapse, modulating synaptic transmission
Cellular Component
GO:0000932 P-body
GO:0005634 nucleus
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0010494 cytoplasmic stress granule
GO:0016281 eukaryotic translation initiation factor 4F complex
GO:0016442 RISC complex
GO:0016604 nuclear body
GO:0016607 nuclear speck
GO:0033391 chromatoid body
GO:0036464 cytoplasmic ribonucleoprotein granule
GO:0048471 perinuclear region of cytoplasm
GO:0070062 extracellular exosome
GO:0098794 postsynapse
GO:0098978 glutamatergic synapse

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:1ipc, PDBe:1ipc, PDBj:1ipc
PDBsum1ipc
PubMed11879179
UniProtP06730|IF4E_HUMAN Eukaryotic translation initiation factor 4E (Gene Name=EIF4E)

[Back to BioLiP]