Structure of PDB 1io6 Chain A Binding Site BS01

Receptor Information
>1io6 Chain A (length=59) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GSTYVQALFDFDPQEDGELGFRRGDFIHVMDNSDPNWWKGACHGQTGMFP
RNYVTPVNR
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1io6 Solution Structure and Ligand-Binding Site of the C-Terminal SH3 Domain of Grb2
ResolutionN/A
Binding residue
(original residue number in PDB)
F9 E15 D34 N36 W37 M48 P50 N52 Y53
Binding residue
(residue number reindexed from 1)
F9 E15 D34 N36 W37 M48 P50 N52 Y53
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:1io6, PDBe:1io6, PDBj:1io6
PDBsum1io6
PubMed
UniProtP62993|GRB2_HUMAN Growth factor receptor-bound protein 2 (Gene Name=GRB2)

[Back to BioLiP]