Structure of PDB 1io4 Chain A Binding Site BS01

Receptor Information

>1io4 Chain A (length=63) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

KHSDEYKIRRERNNIAVRKSRDKAKMRNLETQHKVLELTAENERLQKKVE
QLSRELSTLRNLF

Ligand information

>1io4 Chain E (length=26) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

gaagatttccaaactctgtggttgcg

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	1io4 Structural analyses of DNA recognition by the AML1/Runx-1 Runt domain and its allosteric control by CBFbeta.
Resolution	3.0 Å
Binding residue (original residue number in PDB)	R280 V285 K287 S288
Binding residue (residue number reindexed from 1)	R12 V17 K19 S20
Binding affinity	PDBbind-CN: Kd=7.56nM

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003700	DNA-binding transcription factor activity

	Biological Process
GO:0006351	DNA-templated transcription
GO:0006355	regulation of DNA-templated transcription

View graph for
Molecular Function

View graph for
Biological Process

External links

PDB	RCSB:1io4, PDBe:1io4, PDBj:1io4
PDBsum	1io4
PubMed	11257229
UniProt	P17676\|CEBPB_HUMAN CCAAT/enhancer-binding protein beta (Gene Name=CEBPB)

[Back to BioLiP]