Structure of PDB 1idg Chain A Binding Site BS01

Receptor Information
>1idg Chain A (length=74) Species: 8616 (Bungarus multicinctus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
IVCHTTATSPISAVTCPPGENLCYRKMWCDAFCSSRGKVVELGCAATCPS
KKPYEEVTCCSTDKCNPHPKQRPG
Ligand information
>1idg Chain B (length=18) Species: 7787 (Tetronarce californica) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
YRGWKHWVYYTCCPDTPY
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1idg The solution structure of the complex formed between alpha-bungarotoxin and an 18-mer cognate peptide derived from the alpha 1 subunit of the nicotinic acetylcholine receptor from Torpedo californica.
ResolutionN/A
Binding residue
(original residue number in PDB)		T8 S9 K38 V39 V40 H68 P69
Binding residue
(residue number reindexed from 1)		T8 S9 K38 V39 V40 H68 P69
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0005515 protein binding
GO:0030550 acetylcholine receptor inhibitor activity
GO:0090729 toxin activity
GO:0099106 ion channel regulator activity
Biological Process
GO:0035821 modulation of process of another organism
Cellular Component
GO:0005576 extracellular region

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1idg, PDBe:1idg, PDBj:1idg
PDBsum1idg
PubMed11312275
UniProtP60615|3L21A_BUNMU Alpha-bungarotoxin

[Back to BioLiP]