Structure of PDB 1iak Chain A Binding Site BS01

Receptor Information

>1iak Chain A (length=182) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

IEADHVGSYGITVYQSPGDIGQYTFEFDGDELFYVDLDKKETVWMLPEFA
QLRRFEPQGGLQNIATGKHNLEILTKRSNSTPATNEAPQATVFPKSPVLL
GQPNTLICFVDNIFPPVINITWLRNSKSVTDGVYETSFFVNRDYSFHKLS
YLTFIPSDDDIYDCKVEHWGLEEPVLKHWEPE

Ligand information

>1iak Chain P (length=13) Species: 10090 (Mus musculus) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

STDYGILQINSRW

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	1iak Crystal structure of I-Ak in complex with a dominant epitope of lysozyme.
Resolution	1.9 Å
Binding residue (original residue number in PDB)	Y9 F24 R52 R53 N62 T65 G66 H68 N69 E71 I72 R76
Binding residue (residue number reindexed from 1)	Y9 F25 R53 R54 N63 T66 G67 H69 N70 E72 I73 R77

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Biological Process
GO:0006955	immune response
GO:0019882	antigen processing and presentation

	Cellular Component
GO:0016020	membrane
GO:0042613	MHC class II protein complex

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:1iak, PDBe:1iak, PDBj:1iak
PDBsum	1iak
PubMed	9529148
UniProt	P01910\|HA2K_MOUSE H-2 class II histocompatibility antigen, A-K alpha chain (Gene Name=H2-Aa)

[Back to BioLiP]