Structure of PDB 1i8k Chain A Binding Site BS01

Receptor Information
>1i8k Chain A (length=106) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DIELTQSPASLSVATGEKVTIRCMTSTDIDDDMNWYQQKPGEPPKFLISE
GNTLRPGVPSRFSSSGTGTDFVFTIENTLSEDVGDYYCLQSFNVPLTFGC
GTKLEI
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1i8k Antibody recognition of a conformational epitope in a peptide antigen: Fv-peptide complex of an antibody fragment specific for the mutant EGF receptor, EGFRvIII.
Resolution1.8 Å
Binding residue
(original residue number in PDB)		E50 S91 N93 V94
Binding residue
(residue number reindexed from 1)		E50 S91 N93 V94
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0002250 adaptive immune response
GO:0006955 immune response
Cellular Component
GO:0005615 extracellular space
GO:0019814 immunoglobulin complex

View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1i8k, PDBe:1i8k, PDBj:1i8k
PDBsum1i8k
PubMed11352579
UniProtP01660|KV3A8_MOUSE Ig kappa chain V-III region PC 3741/TEPC 111

[Back to BioLiP]