Structure of PDB 1i6u Chain A Binding Site BS01

Receptor Information
>1i6u Chain A (length=129) Species: 2190 (Methanocaldococcus jannaschii) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SLMDPLANALNHISNCERVGKKVVYIKPASKLIGRVLKVMQDNGYIGEFE
FIEDGRAGIFKVELIGKINKCGAIKPRFPVKKFGYEKFEKRYLPARDFGI
LIVSTTQGVMSHEEAKKRGLGGRLLAYVY
Ligand information
>1i6u Chain C (length=37) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
gggcccgguaagucucuucggagauacugccgggccc
<<<<<<<<<.<<<<<<....>>>>..>>>>>>>>>>>
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1i6u Detailed analysis of RNA-protein interactions within the ribosomal protein S8-rRNA complex from the archaeon Methanococcus jannaschii.
Resolution2.6 Å
Binding residue
(original residue number in PDB)		P6 S31 K32 R36 R57 A58 R78 P80 K82 K83 S105 T106 T107 G122 R124
Binding residue
(residue number reindexed from 1)		P5 S30 K31 R35 R56 A57 R77 P79 K81 K82 S104 T105 T106 G121 R123
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0022627 cytosolic small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1i6u, PDBe:1i6u, PDBj:1i6u
PDBsum1i6u
PubMed11478863
UniProtP54041|RS8_METJA Small ribosomal subunit protein uS8 (Gene Name=rps8)

[Back to BioLiP]