Structure of PDB 1i5k Chain A Binding Site BS01

Receptor Information
>1i5k Chain A (length=79) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ECMHGSGENYDGKISKTMSGLECQAWDSQSPHAHGYIPSKFPNKNLKKNY
CRNPDRDLRPWCFTTDPNKRWEYCDIPRC
Ligand information
>1i5k Chain C (length=26) Species: 1314 (Streptococcus pyogenes) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
EKLTADAELQRLKNERHEEAELERLK
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1i5k Structure and binding determinants of the recombinant kringle-2 domain of human plasminogen to an internal peptide from a group A Streptococcal surface protein.
Resolution2.7 Å
Binding residue
(original residue number in PDB)		Y35 K39 F40 D54 D56 W60 R69 W70 Y72
Binding residue
(residue number reindexed from 1)		Y36 K40 F41 D55 D57 W61 R70 W71 Y73
Enzymatic activity
Enzyme Commision number 3.4.21.7: plasmin.
External links
PDB RCSB:1i5k, PDBe:1i5k, PDBj:1i5k
PDBsum1i5k
PubMed11350170
UniProtP00747|PLMN_HUMAN Plasminogen (Gene Name=PLG)

[Back to BioLiP]