Structure of PDB 1i3z Chain A Binding Site BS01

Receptor Information
>1i3z Chain A (length=103) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MDLPYYHGCLTKRECEALLLKGGVDGNFLIRDSESVPGALCLCVSFKKLV
YSYRIFREKHGYYRIETDAHTPRTIFPNLQELVSKYGKPGQGLVVHLSNP
IMR
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1i3z Structural basis for the interaction of the free SH2 domain EAT-2 with SLAM receptors in hematopoietic cells.
Resolution2.15 Å
Binding residue
(original residue number in PDB)		K12 E16 R31 S33 E34 S35 C41 L49 V50 Y51 S52 Y53 R54 I65 E66 T67 D68 T71 G92
Binding residue
(residue number reindexed from 1)		K12 E16 R31 S33 E34 S35 C41 L49 V50 Y51 S52 Y53 R54 I65 E66 T67 D68 T71 G92
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:1i3z, PDBe:1i3z, PDBj:1i3z
PDBsum1i3z
PubMed11689425
UniProtO35324|SH21B_MOUSE SH2 domain-containing protein 1B (Gene Name=Sh2d1b)

[Back to BioLiP]