Structure of PDB 1hym Chain A Binding Site BS01

Receptor Information
>1hym Chain A (length=44) Species: 3661 (Cucurbita maxima) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SSCPGKSSWPHLVGVGGSVAKAIIERQNPNVKAVILEEGTPVTK
Ligand information
>1hym Chain B (length=24) Species: 3661 (Cucurbita maxima) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
DFRCNRVRIWVNKRGLVVSPPRIG
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1hym Reactive-site hydrolyzed Cucurbita maxima trypsin inhibitor-V: function, thermodynamic stability, and NMR solution structure.
ResolutionN/A
Binding residue
(original residue number in PDB)		C3 S8 W9 V13 G14 G17 I24 V31 K32 A33 V34 L36 E37 E38
Binding residue
(residue number reindexed from 1)		C3 S8 W9 V13 G14 G17 I24 V31 K32 A33 V34 L36 E37 E38
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0004867 serine-type endopeptidase inhibitor activity
Biological Process
GO:0009611 response to wounding

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:1hym, PDBe:1hym, PDBj:1hym
PDBsum1hym
PubMed7547948
UniProtP19873|ITH5_CUCMA Inhibitor of trypsin and hageman factor

[Back to BioLiP]