Structure of PDB 1hxz Chain A Binding Site BS01

Receptor Information

>1hxz Chain A (length=121) Species: 1895 (Streptomyces avidinii) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

AEAGITGTWYNQLGSTFIVTAGADGALTGTYESAVGNAESRYVLTGRYDS
APATDGSGTALGWTVAWKNNYRNAHSATTWSGQYVGGAEARINTQWLLTS
GTTEANAWKSTLVGHDTFTKV

Ligand information

>1hxz Chain C (length=13) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

RCCHPQCGMVEEC

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	1hxz Conformational Ensemble Analysis of Ligand Binding in Streptavidin Mini-Protein Complexes
Resolution	1.8 Å
Binding residue (original residue number in PDB)	Y54 W79 R84 T90 W108
Binding residue (residue number reindexed from 1)	Y42 W67 R72 T78 W96

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0009374	biotin binding

View graph for
Molecular Function

External links

PDB	RCSB:1hxz, PDBe:1hxz, PDBj:1hxz
PDBsum	1hxz
PubMed
UniProt	P22629\|SAV_STRAV Streptavidin

[Back to BioLiP]