Structure of PDB 1hxy Chain A Binding Site BS01

Receptor Information
>1hxy Chain A (length=180) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
EEHVIIQAEFYLNPDQSGEFMFDFDGDEIFHVDMAKKETVWRLEEFGRFA
SFEAQGALANIAVDKANLEIMTKRSNYTPITNVPPEVTVLTNSPVELREP
NVLICFIDKFTPPVVNVTWLRNGKPVTTGVSETVFLPREDHLFRKFHYLP
FLPSTEDVYDCRVEHWGLDEPLLKHWEFDA
Ligand information
>1hxy Chain C (length=13) Species: 385585 (Influenza A virus (A/equine/Jilin/1/1989(H3N8))) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
PKYVKQNTLKLAT
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1hxy Crystal Structure of a Superantigen Bound to MHC Class II Displays Zinc and Peptide Dependence
Resolution2.6 Å
Binding residue
(original residue number in PDB)		Q9 E11 F51 A52 S53 G58 N62 V65 D66 N69 M73 R76
Binding residue
(residue number reindexed from 1)		Q7 E9 F49 A50 S51 G56 N60 V63 D64 N67 M71 R74
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0006955 immune response
GO:0019882 antigen processing and presentation
Cellular Component
GO:0016020 membrane
GO:0042613 MHC class II protein complex

View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1hxy, PDBe:1hxy, PDBj:1hxy
PDBsum1hxy
PubMed11432818
UniProtP01903|DRA_HUMAN HLA class II histocompatibility antigen, DR alpha chain (Gene Name=HLA-DRA)

[Back to BioLiP]