Structure of PDB 1hxl Chain A Binding Site BS01

Receptor Information
>1hxl Chain A (length=119) Species: 1895 (Streptomyces avidinii) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GITGTWYNQLGSTFIVTAGADGALTGTYESAVGNAESRYVLTGRYDSAPA
TDGSGTALGWTVAWKNNYRNAHSATTWSGQYVGGAEARINTQWLLTSGTT
EANAWKSTLVGHDTFTKVK
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1hxl Conformational Ensemble Analysis of Ligand Binding in Streptavidin Mini-Protein Complexes
Resolution1.8 Å
Binding residue
(original residue number in PDB)		Y54 W79 R84 T90 W108 L110
Binding residue
(residue number reindexed from 1)		Y39 W64 R69 T75 W93 L95
Enzymatic activity
Enzyme Commision number ?
Gene Ontology

View graph for
Molecular Function
External links
PDB RCSB:1hxl, PDBe:1hxl, PDBj:1hxl
PDBsum1hxl
PubMed
UniProtP22629|SAV_STRAV Streptavidin

[Back to BioLiP]