Structure of PDB 1hv2 Chain A Binding Site BS01

Receptor Information
>1hv2 Chain A (length=99) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MSQDFVTLVSKDDKEYEISRSAAMISPTLKAMIEGPFRESKGRIELKQFD
SHILEKAVEYLNYNLKYSGVSEDDDEIPEFEIPTEMSLELLLAADYLSI
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1hv2 Solution structure and dynamics of yeast elongin C in complex with a von Hippel-Lindau peptide.
ResolutionN/A
Binding residue
(original residue number in PDB)		Y60 F80 I82 T84 S87 L91 A94 D95
Binding residue
(residue number reindexed from 1)		Y60 F80 I82 T84 S87 L91 A94 D95
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0004842 ubiquitin-protein transferase activity
GO:0005515 protein binding
GO:0030674 protein-macromolecule adaptor activity
Biological Process
GO:0006289 nucleotide-excision repair
GO:0006511 ubiquitin-dependent protein catabolic process
GO:0009411 response to UV
GO:0070911 global genome nucleotide-excision repair
Cellular Component
GO:0000113 nucleotide-excision repair factor 4 complex
GO:0005634 nucleus
GO:0005737 cytoplasm
GO:0031463 Cul3-RING ubiquitin ligase complex
GO:0070449 elongin complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1hv2, PDBe:1hv2, PDBj:1hv2
PDBsum1hv2
PubMed11545595
UniProtQ03071|ELOC_YEAST Elongin-C (Gene Name=ELC1)

[Back to BioLiP]