Structure of PDB 1hqw Chain A Binding Site BS01

Receptor Information

>1hqw Chain A (length=237) Species: 3823 (Canavalia ensiformis) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

ADTIVAVELDTYPNTDIGDPSYPHIGIDIKSVRSKKTAKWNMQNGKVGTA
HIIYNSVDKRLSAVVSYPNADSATVSYDVDLDNVLPEWVRVGLSASTGLY
KETNTILSWSFTSKLKSNSTHETNALHFMFNQFSKDQKDLILQGDATTGT
DGNLELTRVSSNGSPQGSSVGRALFYAPVHIWESSAVVASFEATFTFLIK
SPDSHPADGIAFFISNIDSSIPSGSTGRLLGLFPDAN

Ligand information

>1hqw Chain B (length=3) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

YPY

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	1hqw Crystal structure of the complex of concanavalin A and tripeptide
Resolution	2.4 Å
Binding residue (original residue number in PDB)	T15 S21
Binding residue (residue number reindexed from 1)	T15 S21

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0030246	carbohydrate binding

View graph for
Molecular Function

External links

PDB	RCSB:1hqw, PDBe:1hqw, PDBj:1hqw
PDBsum	1hqw
PubMed	11330349
UniProt	P02866\|CONA_CANEN Concanavalin-A

[Back to BioLiP]