Structure of PDB 1hq1 Chain A Binding Site BS01

Receptor Information
>1hq1 Chain A (length=76) Species: 562 (Escherichia coli) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GFDLNDFLEQLRQDDKVLVRMEAIINSMTMKERAKPEIIKGSRKRRIAAG
SGMQVQDVNRLLKQFDDMQRMMKKMK
Ligand information
>1hq1 Chain B (length=49) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
ggcucuguuuaccaggucagguccgaaaggaagcagccaaggcagagcc
<<<<<<<<<<....<<<..<.<<<....>>>..>.>>>.>>>>>>>>>>
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1hq1 Structural and energetic analysis of RNA recognition by a universally conserved protein from the signal recognition particle.
Resolution1.52 Å
Binding residue
(original residue number in PDB)		R27 A30 N33 S34 M35 K38 S49 R50 R53 G57 S58 G59 M60
Binding residue
(residue number reindexed from 1)		R20 A23 N26 S27 M28 K31 S42 R43 R46 G50 S51 G52 M53
Binding affinityPDBbind-CN: Kd=33pM
Enzymatic activity
Enzyme Commision number 3.6.5.4: signal-recognition-particle GTPase.
Gene Ontology
Molecular Function
GO:0003924 GTPase activity
GO:0005525 GTP binding
GO:0008312 7S RNA binding
Biological Process
GO:0006614 SRP-dependent cotranslational protein targeting to membrane
Cellular Component
GO:0048500 signal recognition particle

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1hq1, PDBe:1hq1, PDBj:1hq1
PDBsum1hq1
PubMed11243816
UniProtP0AGD7|SRP54_ECOLI Signal recognition particle protein (Gene Name=ffh)

[Back to BioLiP]