Structure of PDB 1hpg Chain A Binding Site BS01

Receptor Information
>1hpg Chain A (length=187) Species: 1911 (Streptomyces griseus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
VLGGGAIYGGGSRCSAAFNVTKGGARYFVTAGHCTNISANWSASSGGSVV
GVREGTSFPTNDYGIVRYTDGSSPAGTVDLYNGSTQDISSAANAVVGQAI
KKSGSTTKVTSGTVTAVNVTVNYGDGPVYNMVRTTACSAGGDSGGAHFAG
SVALGIHSGSSGCSGTAGSAIHQPVTEALSAYGVTVY
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1hpg A glutamic acid specific serine protease utilizes a novel histidine triad in substrate binding.
Resolution1.5 Å
Binding residue
(original residue number in PDB)		H57 Y171 S192 G192B G193 S195 H213 S214 G215 S216 S217
Binding residue
(residue number reindexed from 1)		H33 Y123 S138 G140 G141 S143 H157 S158 G159 S160 S161
Enzymatic activity
Catalytic site (original residue number in PDB) H57 D102 G193 S195 S214
Catalytic site (residue number reindexed from 1) H33 D62 G141 S143 S158
Enzyme Commision number 3.4.21.82: glutamyl endopeptidase II.
Gene Ontology
Molecular Function
GO:0004252 serine-type endopeptidase activity
GO:0008236 serine-type peptidase activity
Biological Process
GO:0006508 proteolysis

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:1hpg, PDBe:1hpg, PDBj:1hpg
PDBsum1hpg
PubMed8105890
UniProtQ07006|GLUP_STRGR Glutamyl endopeptidase 2 (Gene Name=sprE)

[Back to BioLiP]