Structure of PDB 1hlv Chain A Binding Site BS01

Receptor Information
>1hlv Chain A (length=131) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MGPKRRQLTFREKSRIIQEVEENPDLRKGEIARRFNIPPSTLSTILKNKR
AILASERKYGVASTCRKTNKLSPYDKLEGLLIAWFQQIRAAGLPVKGIIL
KEKALRIAEELGMDDFTASNGWLDRFRRRRS
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1hlv Crystal structure of the CENP-B protein-DNA complex: the DNA-binding domains of CENP-B induce kinks in the CENP-B box DNA.
Resolution2.5 Å
Binding residue
(original residue number in PDB)		P3 R5 R27 K28 G29 S43 K47 R66 T68 K70 S72 P73 Y74 S119 N120 G121 W122 R125 R129
Binding residue
(residue number reindexed from 1)		P3 R5 R27 K28 G29 S43 K47 R66 T68 K70 S72 P73 Y74 S119 N120 G121 W122 R125 R129
Enzymatic activity
Enzyme Commision number ?
Gene Ontology

View graph for
Molecular Function
External links
PDB RCSB:1hlv, PDBe:1hlv, PDBj:1hlv
PDBsum1hlv
PubMed11726497
UniProtP07199|CENPB_HUMAN Major centromere autoantigen B (Gene Name=CENPB)

[Back to BioLiP]