Structure of PDB 1hh9 Chain A Binding Site BS01

Receptor Information

>1hh9 Chain A (length=214) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

DIKMTQSPSSMYTSLGERVTITCKASQDINSFLTWFLQKPGKSPKTLIYR
ANRLMIGVPSRFSGSGSGQTYSLTISSLEYEDMGIYYCLQYDDFPLTFGA
GTKLDLKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKEINVKWKI
DGSERQNGVLDSWTEQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKT
STSPIVKSFNRNEC

Ligand information

>1hh9 Chain C (length=11) Species: 32630 (synthetic construct) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

DATPEDLNAKL

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	1hh9 Evolutionary Transition Pathways for Changing Peptide Ligand Specificity and Structure
Resolution	2.7 Å
Binding residue (original residue number in PDB)	F32 Y49 R50 Y91 D92 F94
Binding residue (residue number reindexed from 1)	F32 Y49 R50 Y91 D92 F94

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Biological Process
GO:0030183	B cell differentiation

	Cellular Component
GO:0005576	extracellular region
GO:0005886	plasma membrane

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:1hh9, PDBe:1hh9, PDBj:1hh9
PDBsum	1hh9
PubMed	10990450
UniProt	P01837\|IGKC_MOUSE Immunoglobulin kappa constant (Gene Name=Igkc)

[Back to BioLiP]