Structure of PDB 1hcr Chain A Binding Site BS01

Receptor Information
>1hcr Chain A (length=52) Species: 99287 (Salmonella enterica subsp. enterica serovar Typhimurium str. LT2) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GRPRAINKHEQEQISRLLEKGHPRQQLAIIFGIGVSTLYRYFPASSIKKR
MN
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1hcr Hin recombinase bound to DNA: the origin of specificity in major and minor groove interactions.
Resolution2.3 Å
Binding residue
(original residue number in PDB)
G139 R140 R142 A143 G172 S174 T175 R178 Y179 I185 K186 K187 R188 M189 N190
Binding residue
(residue number reindexed from 1)
G1 R2 R4 A5 G34 S36 T37 R40 Y41 I47 K48 K49 R50 M51 N52
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0000150 DNA strand exchange activity
GO:0003677 DNA binding
Biological Process
GO:0006310 DNA recombination

View graph for
Molecular Function

View graph for
Biological Process
External links
PDB RCSB:1hcr, PDBe:1hcr, PDBj:1hcr
PDBsum1hcr
PubMed8278807
UniProtP03013|HIN_SALTY DNA-invertase hin (Gene Name=hin)

[Back to BioLiP]