Structure of PDB 1hc8 Chain A Binding Site BS01

Receptor Information
>1hc8 Chain A (length=74) Species: 1422 (Geobacillus stearothermophilus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
TFITKTPPAAVLLKKAAGIESGSGEPNRNKVATIKRDKVREIAELKMPDL
NAASIEAAMRMIEGTARSMGIVVE
Ligand information
>1hc8 Chain C (length=58) [Search RNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
gccaggauguaggcuuagaagcagccaucauuuaaagaaagcguaauagc
ucacuggu
<<<<<.<<...<<<<.......>>>>...>>........<<<......>>
>..>>>>>
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1hc8 A Compact RNA Tertiary Structure Contains a Buried Backbone-K+ Complex
Resolution2.8 Å
Binding residue
(original residue number in PDB)		P9 A10 K15 S22 G23 S24 G25 E26 P27 N28 R29 K47 L51 N52 A54 A58 R61 M62 G65 T66 R68 S69 M70
Binding residue
(residue number reindexed from 1)		P8 A9 K14 S21 G22 S23 G24 E25 P26 N27 R28 K46 L50 N51 A53 A57 R60 M61 G64 T65 R67 S68 M69
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1hc8, PDBe:1hc8, PDBj:1hc8
PDBsum1hc8
PubMed12054794
UniProtP56210|RL11_GEOSE Large ribosomal subunit protein uL11 (Fragment) (Gene Name=rplK)

[Back to BioLiP]