Structure of PDB 1h9o Chain A Binding Site BS01

Receptor Information
>1h9o Chain A (length=108) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GSPIPHHDEKTWNVGSSNRNKAENLLRGKRDGTFLVRESSKQGCYACSVV
VDGEVKHCVINKTATGYGFAEPYNLYSSLKELVLHYQHTSLVQHNDSLNV
TLAYPVYA
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1h9o NMR Trial Models: Experiences with the Colicin Immunity Protein Im7 and the P85Alpha C-Terminal Sh2-Peptide Complex
Resolution1.79 Å
Binding residue
(original residue number in PDB)
R19 R37 S39 S40 H57 V59 F69 H94 N95 L98 Y107 A108
Binding residue
(residue number reindexed from 1)
R19 R37 S39 S40 H57 V59 F69 H94 N95 L98 Y107 A108
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:1h9o, PDBe:1h9o, PDBj:1h9o
PDBsum1h9o
PubMed11567151
UniProtP27986|P85A_HUMAN Phosphatidylinositol 3-kinase regulatory subunit alpha (Gene Name=PIK3R1)

[Back to BioLiP]