Structure of PDB 1h8b Chain A Binding Site BS01

Receptor Information
>1h8b Chain A (length=73) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MADTDTAEQVIASFRILASDKPYILAEELRRELPPDQAQYCIKRMPAYSG
PGSVPGALDYAAFSSALYGESDL
Ligand information
>1h8b Chain B (length=23) Species: 9986 (Oryctolagus cuniculus) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
GKKAEAVATVVAAVDQARVREPR
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1h8b Ca2+-Independent Binding of an EF-Hand Domain to a Novel Motif in the Alpha-Actinin-Titin Complex
ResolutionN/A
Binding residue
(original residue number in PDB)		S13 F14 I16 E32 L33 Q37 L67
Binding residue
(residue number reindexed from 1)		S13 F14 I16 E32 L33 Q37 L67
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:1h8b, PDBe:1h8b, PDBj:1h8b
PDBsum1h8b
PubMed11573089
UniProtP35609|ACTN2_HUMAN Alpha-actinin-2 (Gene Name=ACTN2)

[Back to BioLiP]