Structure of PDB 1h6e Chain A Binding Site BS01

Receptor Information
>1h6e Chain A (length=219) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
IKYRRNELFLDVLESVNLLMSPQGQVLSAHVSGRVVMKSYLSGMPECKFG
MNDSISFIPPDGEFELMRYRTTKDIILPFRVIPLVREVGRTKLEVKVVIK
SNFKPSLLAQKIEVRIPTPLNTSGVQVICMKGKAKYKASENAIVWKIKRM
AGMKESQISAEIELLPTPPISMNFEVPFAPSGLKVRYLKVFEPKLNYSDH
DVIKWVRYIGRSGIYETRC
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1h6e Study of the Interaction of the Medium Chain Mu2 Subunit of the Clathrin-Associated Adapter Protein Complex 2 with Cytotoxic T-Lymphocyte Antigen 4 and Cd28
Resolution3.6 Å
Binding residue
(original residue number in PDB)		F174 D176 K203 Q318 V401 K420 W421 V422 R423 I425
Binding residue
(residue number reindexed from 1)		F9 D11 K38 Q110 V185 K204 W205 V206 R207 I209
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0006886 intracellular protein transport
GO:0016192 vesicle-mediated transport
Cellular Component
GO:0030131 clathrin adaptor complex

View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1h6e, PDBe:1h6e, PDBj:1h6e
PDBsum1h6e
PubMed11583591
UniProtQ96CW1|AP2M1_HUMAN AP-2 complex subunit mu (Gene Name=AP2M1)

[Back to BioLiP]