Structure of PDB 1h3h Chain A Binding Site BS01

Receptor Information
>1h3h Chain A (length=60) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GRVRWARALYDFEALEEDELGFRSGEVVEVLDSSNPSWWTGRLHNKLGLF
PANYVAPMMR
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1h3h Structural Basis for Specific Binding of the Gads SH3 Domain to an Rxxk Motif-Containing Slp-76 Peptide: A Novel Mode of Peptide Recognition
ResolutionN/A
Binding residue
(original residue number in PDB)		E31 N50 W53 P66 N68 Y69
Binding residue
(residue number reindexed from 1)		E16 N35 W38 P51 N53 Y54
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:1h3h, PDBe:1h3h, PDBj:1h3h
PDBsum1h3h
PubMed12620234
UniProtO89100|GRAP2_MOUSE GRB2-related adaptor protein 2 (Gene Name=Grap2)

[Back to BioLiP]