Structure of PDB 1h2c Chain A Binding Site BS01

Receptor Information
>1h2c Chain A (length=124) Species: 205488 (Ebola virus sp.) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
VSSAFILEAMVNVISGPKVLMKQIPIWLPLGVADQKTYSFDSTTAAIMLA
SYTITHFGKATNPLVRVNRLGPGIPDHPLRLLRIGNQAFLQEFVLPPVQL
PQYFTFDLTALKLITQPLPAATWT
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1h2c The Matrix Protein Vp40 from Ebola Virus Octamerizes Into Pore-Like Structures with Specific RNA Binding Properties
Resolution1.6 Å
Binding residue
(original residue number in PDB)
F125 G126 K127 R134 T192
Binding residue
(residue number reindexed from 1)
F57 G58 K59 R66 T124
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:1h2c, PDBe:1h2c, PDBj:1h2c
PDBsum1h2c
PubMed12679020
UniProtQ05128|VP40_EBOZM Matrix protein VP40 (Gene Name=VP40)

[Back to BioLiP]