Structure of PDB 1gzl Chain A Binding Site BS01

Receptor Information
>1gzl Chain A (length=45) Species: 11706,559292 [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
RMKQIEDKIEEIESKQKKIENEIARIKKLLQLTVWGIKQLQARIL
Ligand information
>1gzl Chain C (length=12) Species: 12721 (Human immunodeficiency virus) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
WEEWDREIENYT
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1gzl Short Constrained Peptides that Inhibit HIV-1 Entry
Resolution1.8 Å
Binding residue
(original residue number in PDB)
K28 L29 L32 W35 G36
Binding residue
(residue number reindexed from 1)
K28 L29 L32 W35 G36
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:1gzl, PDBe:1gzl, PDBj:1gzl
PDBsum1gzl
PubMed12417739
UniProtP03069|GCN4_YEAST General control transcription factor GCN4 (Gene Name=GCN4);
P04578|ENV_HV1H2 Envelope glycoprotein gp160 (Gene Name=env)

[Back to BioLiP]