Structure of PDB 1gua Chain A Binding Site BS01

Receptor Information
>1gua Chain A (length=167) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MREYKLVVLGSGGVGKSALTVQFVQGIFVDEYDPTIEDSYRKQVEVDCQQ
CMLEILDTAGTEQFTAMRDLYMKNGQGFALVYSITAQSTFNDLQDLREQI
LRVKDTEDVPMILVGNKCDLEDERVVGKEQGQNLARQWCNCAFLESSAKS
KINVNEIFYDLVRQINR
Ligand information
Ligand IDMG
InChIInChI=1S/Mg/q+2
InChIKeyJLVVSXFLKOJNIY-UHFFFAOYSA-N
SMILES
SoftwareSMILES
ACDLabs 10.04
OpenEye OEToolkits 1.5.0		[Mg+2]
CACTVS 3.341[Mg++]
FormulaMg
NameMAGNESIUM ION
ChEMBL
DrugBankDB01378
ZINC
PDB chain1gua Chain A Residue 171 [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1gua Ras/Rap effector specificity determined by charge reversal.
Resolution2.0 Å
Binding residue
(original residue number in PDB)		S17 T35
Binding residue
(residue number reindexed from 1)		S17 T35
Annotation score1
Enzymatic activity
Enzyme Commision number 3.6.5.2: small monomeric GTPase.
Gene Ontology
Molecular Function
GO:0003924 GTPase activity
GO:0003925 G protein activity
GO:0005085 guanyl-nucleotide exchange factor activity
GO:0005515 protein binding
GO:0005525 GTP binding
GO:0016787 hydrolase activity
GO:0019003 GDP binding
GO:0031267 small GTPase binding
GO:0044877 protein-containing complex binding
Biological Process
GO:0007165 signal transduction
GO:0007264 small GTPase-mediated signal transduction
GO:0007399 nervous system development
GO:0010976 positive regulation of neuron projection development
GO:0016079 synaptic vesicle exocytosis
GO:0030033 microvillus assembly
GO:0032486 Rap protein signal transduction
GO:0038180 nerve growth factor signaling pathway
GO:0043547 positive regulation of GTPase activity
GO:0045860 positive regulation of protein kinase activity
GO:0061028 establishment of endothelial barrier
GO:0070374 positive regulation of ERK1 and ERK2 cascade
GO:0071320 cellular response to cAMP
GO:0072659 protein localization to plasma membrane
GO:0098696 regulation of neurotransmitter receptor localization to postsynaptic specialization membrane
GO:1901888 regulation of cell junction assembly
GO:1990090 cellular response to nerve growth factor stimulus
GO:2000301 negative regulation of synaptic vesicle exocytosis
GO:2001214 positive regulation of vasculogenesis
Cellular Component
GO:0005737 cytoplasm
GO:0005768 endosome
GO:0005769 early endosome
GO:0005770 late endosome
GO:0005829 cytosol
GO:0005886 plasma membrane
GO:0010008 endosome membrane
GO:0016020 membrane
GO:0030054 cell junction
GO:0032045 guanyl-nucleotide exchange factor complex
GO:0035579 specific granule membrane
GO:0043005 neuron projection
GO:0048471 perinuclear region of cytoplasm
GO:0070062 extracellular exosome
GO:0070161 anchoring junction
GO:0097225 sperm midpiece
GO:0098793 presynapse
GO:0098978 glutamatergic synapse

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1gua, PDBe:1gua, PDBj:1gua
PDBsum1gua
PubMed8756332
UniProtP62834|RAP1A_HUMAN Ras-related protein Rap-1A (Gene Name=RAP1A)

[Back to BioLiP]