Structure of PDB 1gu5 Chain A Binding Site BS01

Receptor Information
>1gu5 Chain A (length=65) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DKHSDEYKIRRERNNIAVRKSRDKAKMRNLETQHKVLELTAENERLQKKV
EQLSRELSTLRNLFK
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1gu5 Mechanism of C-Myb-C/Ebpbeta Cooperation from Separated Sites on a Promoter
Resolution2.1 Å
Binding residue
(original residue number in PDB)
Y274 R278 N281 N282 R286 K293
Binding residue
(residue number reindexed from 1)
Y7 R11 N14 N15 R19 K26
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003700 DNA-binding transcription factor activity
Biological Process
GO:0006351 DNA-templated transcription
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function

View graph for
Biological Process
External links
PDB RCSB:1gu5, PDBe:1gu5, PDBj:1gu5
PDBsum1gu5
PubMed
UniProtP17676|CEBPB_HUMAN CCAAT/enhancer-binding protein beta (Gene Name=CEBPB)

[Back to BioLiP]