Structure of PDB 1goy Chain A Binding Site BS01

Receptor Information

>1goy Chain A (length=108) Species: 1400 (Bacillus intermedius)

VINTFDGVADYLIRYKRLPNDYITKSQASALGWVASKGDLAEVAPGKSIG
GDVFSNREGRLPSAGSRTWREADINYVSGFRNADRLVYSSDWLIYKTTDH
YATFTRIR

Ligand information

• Ligand ID: 3GP
• InChI: InChI=1S/C10H14N5O8P/c11-10-13-7-4(8(18)14-10)12-2-15(7)9-5(17)6(3(1-16)22-9)23-24(19,20)21/h2-3,5-6,9,16-17H,1H2,(H2,19,20,21)(H3,11,13,14,18)/t3-,5-,6-,9-/m1/s1
• InChIKey: ZDPUTNZENXVHJC-UUOKFMHZSA-N
• SMILES:
  OpenEye OEToolkits 1.5.0: c1nc2c(n1C3C(C(C(O3)CO)OP(=O)(O)O)O)N=C(NC2=O)N
  CACTVS 3.341: NC1=Nc2n(cnc2C(=O)N1)[CH]3O[CH](CO)[CH](O[P](O)(O)=O)[CH]3O
  OpenEye OEToolkits 1.5.0: c1nc2c(n1[C@H]3[C@@H]([C@@H]([C@H](O3)CO)OP(=O)(O)O)O)N=C(NC2=O)N
  CACTVS 3.341: NC1=Nc2n(cnc2C(=O)N1)[C@@H]3O[C@H](CO)[C@@H](O[P](O)(O)=O)[C@H]3O
  ACDLabs 10.04: O=C1c2ncn(c2N=C(N)N1)C3OC(C(OP(=O)(O)O)C3O)CO
• Formula: C10 H14 N5 O8 P
• Name: GUANOSINE-3'-MONOPHOSPHATE
• DrugBank: DB03315
• ZINC: ZINC000004807333
• PDB chain: 1goy Chain A Residue 201

Receptor-Ligand Complex Structure

Structure summary

• PDB: 1goy The Structure of Substrate-Free Microbial Ribonuclease Binase and of its Complexes with 3'Gmp and Sulfate Ions
• Resolution: 2.0 Å
• Binding residue (original residue number in PDB): K26 V54 F55 S56 N57 R58 E59 E72 R82 R86 H101 Y102
• Binding residue (residue number reindexed from 1): K25 V53 F54 S55 N56 R57 E58 E71 R81 R85 H100 Y101
• Annotation score: 4

Enzymatic activity

• Enzyme Commision number: 3.1.27.-

Gene Ontology

Molecular Function

• GO:0003723 RNA binding
• GO:0004521 RNA endonuclease activity
• GO:0004540 RNA nuclease activity

External links

• PDB: RCSB:1goy, PDBe:1goy, PDBj:1goy
• PDBsum: 1goy
• PubMed: 11976484
• UniProt: P00649|RN_BACIN Ribonuclease