Structure of PDB 1gcc Chain A Binding Site BS01

Receptor Information
>1gcc Chain A (length=63) Species: 3702 (Arabidopsis thaliana) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KHYRGVRQRPWGKFAAEIRDPAKNGARVWLGTFETAEDAALAYDRAAFRM
RGSRALLNFPLRV
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1gcc A novel mode of DNA recognition by a beta-sheet revealed by the solution structure of the GCC-box binding domain in complex with DNA.
ResolutionN/A
Binding residue
(original residue number in PDB)		R152 W154 K156 R170 W172 G174 T175
Binding residue
(residue number reindexed from 1)		R9 W11 K13 R27 W29 G31 T32
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003700 DNA-binding transcription factor activity
Biological Process
GO:0006355 regulation of DNA-templated transcription
GO:0009873 ethylene-activated signaling pathway

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:1gcc, PDBe:1gcc, PDBj:1gcc
PDBsum1gcc
PubMed9736626
UniProtO80337|EF100_ARATH Ethylene-responsive transcription factor 1A (Gene Name=ERF1A)

[Back to BioLiP]