Structure of PDB 1gbr Chain A Binding Site BS01

Receptor Information
>1gbr Chain A (length=74) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GSRRASVGSMEAIAKYDFKATADDELSFKRGDILKVLNEECDQNWYKAEL
NGKDGFIPKNYIEMKPHPEFIVTD
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1gbr Orientation of peptide fragments from Sos proteins bound to the N-terminal SH3 domain of Grb2 determined by NMR spectroscopy.
ResolutionN/A
Binding residue
(original residue number in PDB)
Y7 W36 P49 N51 Y52
Binding residue
(residue number reindexed from 1)
Y16 W45 P58 N60 Y61
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:1gbr, PDBe:1gbr, PDBj:1gbr
PDBsum1gbr
PubMed7947763
UniProtQ60631|GRB2_MOUSE Growth factor receptor-bound protein 2 (Gene Name=Grb2)

[Back to BioLiP]